1*,4Department of Microbiology, Saveetha Medical College and Hospital, Saveetha Institute of Medical and Technical Sciences (SIMATS), Saveetha University, Thandalam, Chennai - 602105, Tamil Nadu, India
2Department of Biomedical Sciences, Saveetha College of Allied Health Sciences, Saveetha Institute of Medical and Technical Sciences, Saveetha University, Thandalam, Chennai- 602105, Tamil Nadu, India
3Department of Community Medicine, Saveetha Medical College and Hospital, Saveetha Institute of Medical and Technical Sciences (SIMATS), Saveetha University, Thandalam, Chennai- 602105, Tamil Nadu, India
5Department of Biochemistry, Basic Medical Sciences, Michael Chilufya Sata School of Medicine, The Copperbelt University, Ndola, Zambia
6Department of Medical Laboratory Technology, Saveetha College of Allied Health Sciences, Saveetha Institute of Medical and Technical Sciences, Saveetha University, Thandalam, Chennai- 602105, Tamil Nadu, India
Pharmaceuticals that employ peptides, or short chains of amino acids, as therapeutic agents are known as peptide-based drugs. These drugs offer a fresh method of treating a range of illnesses by mimicking or blocking the actions of natural proteins, hormones, or enzymes. Human, animal, and bird infections are spread by Anopheles gambiae. Humans suffer from several severe health problems as a result. The effectiveness of the peptide derived from Boerhavia diffusa against Anopheles gambiae was determined in this investigation. We use in silico techniques to analyse the new peptide's insecticidal characteristics. Protein-peptide docking investigations using automated in silico methods were part of the study's methodology. Using sophisticated 3D macromolecular visualization tools, all the data were explained. The effectiveness of the new peptide against Anopheles gambiae (African malaria mosquito) was amply demonstrated by the full docking data. The new peptide (SFQALLERIYFHVKIEYLVKVLTKNCRIILWLFKDPFTHYIRYQGKSILS) (https://www.modelarchive.org/doi/10.5452/ma-4whza) was ultimately found to have superior inhibitory activity against Anopheles gambiae. As a result, the de novo peptide functions as a possible treatment for Anopheles gambiae.
Keywords: NA
How to cite this article: Ramarao V, Natarajan K, Mary RA, Venkatesan S, Subramanian B, Yokesh V. Discovery of Novel Peptides Targeting Anopheles Gambiae Using In Silico Approaches. Int J Drug Deliv Technol. 2026;16(3): 132-139. DOI: 10.25258/ijddt.16.3.17
Source of support: Nil.
Conflict of interest: None